Transcript | Ll_transcript_297333 |
---|---|
CDS coordinates | 1013-1399 (+) |
Peptide sequence | MGKSPAKWIKNVLFGKKSSKSNVSKGREKLVNQTEGVVPSKLSETGLALDPTPNINARNEEDPRLQDKEAENVLPGSQEIDTVESVQQDAPLDPEKIRLGEAATKAQAAFRGYLARRAFRALKGIIRLQ |
ORF Type | 3prime_partial |
Blastp | Protein IQ-DOMAIN 31 from Arabidopsis with 46.15% of identity |
---|---|
Blastx | Ubiquitin-conjugating enzyme E2 2 from Medicago with 96.3% of identity |
Eggnog | IQ-domain(ENOG410YAVA) |
Kegg | Link to kegg annotations (AT1G74690) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463745.1) |
Pfam | IQ calmodulin-binding motif (PF00612.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer