| Transcript | Ll_transcript_297335 |
|---|---|
| CDS coordinates | 2216-2590 (+) |
| Peptide sequence | MGKSPAKWIKNVLFGKKSSKSNVSKGREKLVNQTEGVVPSKLSETGLALDPTPNINARNEEDPRLQDKEAENVLPGSQEIDTVESVQQDAPLDPEKIRLGEAATKAQAAFRGYLVSNLLFYILN* |
| ORF Type | complete |
| Blastp | Protein IQ-DOMAIN 31 from Arabidopsis with 56.25% of identity |
|---|---|
| Blastx | Protein IQ-DOMAIN 31 from Arabidopsis with 54.89% of identity |
| Eggnog | IQ-domain(ENOG410YAVA) |
| Kegg | Link to kegg annotations (AT1G74690) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019463745.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer