Protein coding transcript 109856

• Transcript: Ll_transcript_295887
• CDS coordinates: 3-491 (+)
• Peptide sequence: QIAKWIEQILPFSLLLFVVFIRQHLQGFFVTIWISAVMFKSNEIVKRQTALKGDRRVSILVGISIAFMLHVMCIYWWYRNDDLLCPLVMIPPKATPFWHSIFIILVNDTLARQAAMAFKCFLLIYYKNGRGHNFRRQAQMLTLVEYTLLLYRALLPTPVWYRF
• ORF Type: internal

Annotations of Ll_transcript_295887

• Blastp: RING finger and transmembrane domain-containing protein 2 from Mus with 21.95% of identity
• Blastx: RING finger and transmembrane domain-containing protein 2 from Mus with 21.95% of identity
• Eggnog: Ring finger protein, transmembrane(ENOG4111HH8)
• Kegg: Link to kegg annotations (269695)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460921.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;