Protein coding transcript 109864

• Transcript: Ll_transcript_296559
• CDS coordinates: 701-1312 (+)
• Peptide sequence: MQIAVVEFTRSVLGVHDANSTEFDPNVKSPVVIFMPEGSKTHMGGTMRLGSRRTFFQTKDCKSAKLYGCKSFIDERHRHRYEVNPDFVVRLENAGLSFTGKDETGKRMEIVELPNHPYFIGVQFHPEFKSKPGKPSPLFLGLIAAACGQLDTVLQHSSNVDSCGLSKAVGTDVLAIKAYNKKAVIKAAYMPEYVYGSLNGYHF*
• ORF Type: complete

Annotations of Ll_transcript_296559

• Blastp: CTP synthase 2 from Xenopus with 58.43% of identity
• Blastx: CTP synthase 1 from Mus with 51.49% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (444477)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422180.1)
• Pfam: Glutamine amidotransferase class-I (PF00117.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;