Protein coding transcript 109871

• Transcript: Ll_transcript_296547
• CDS coordinates: 1128-2471 (+)
• Peptide sequence: MPFIQALGQFSYRVGAGNFCLVHVSLVPVLNVVGEQKTKPTQHSVRGLRGQGLTPHILACRSTTVLDENAKRKLSQFCLIQEENIVTLYDVPNIWHIPLLLRDQKAHEAIFKVLNLYGVVEPNLEEWTRRAEACDLLHEQVHIALVGKYTGLSDAYLSILKALVHASVDCHKKLFVDWISATNLEDATAKENPDAYKTAWKLLKGADGVLVPGGFGDRGVQGKILAAKYARENRIPYLGICLGMQIAVIEFARSVLGVHDANSTEFDPNAKNPVIIFMPEGSKTHMGGTMRLGSRRTFFQTKECKSAKLYGCKGFIEERHRHRYEVNPDLVACLENAGLSFTGKDETGKRMEIVEVPNHPYFIGVQFHPEFKSRPGKPSPLFLGFIAAACGKLDNMLQHPSSVESNGLSKAVGTGVVSAVKAHNKKTAMKPAYRPEYVYGSCNGYHY*
• ORF Type: complete

Annotations of Ll_transcript_296547

• Blastp: CTP synthase 2 from Xenopus with 51.62% of identity
• Blastx: CTP synthase 1 from Mus with 49.9% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (444477)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446965.1)
• Pfam: CTP synthase N-terminus (PF06418.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;