Protein coding transcript 109880

• Transcript: Ll_transcript_296549
• CDS coordinates: 2050-2664 (+)
• Peptide sequence: MQIAVIEFARSVLGVHDANSTEFDPNAKNPVIIFMPEGSKTHMGGTMRLGSRRTFFQTKECKSAKLYGCKGFIEERHRHRYEVNPDLVACLENAGLSFTGKDETGKRMEIVEVPNHPYFIGVQFHPEFKSRPGKPSPLFLGFIAAACGKLDNMLQHPSSVESNGLSKAVGTGVVSAVKAHNKKTAMKPAYRPEYVYGSCNGYHY*
• ORF Type: complete

Annotations of Ll_transcript_296549

• Blastp: CTP synthase 2 from Xenopus with 62.82% of identity
• Blastx: CTP synthase 2 from Xenopus with 59.81% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (444477)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446965.1)
• Pfam: Glutamine amidotransferase class-I (PF00117.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;