Protein coding transcript 109896

• Transcript: Ll_transcript_297480
• CDS coordinates: 2806-3510 (+)
• Peptide sequence: MEGLSAKSVVVSFISQLIVFLYLLDNDTSWMILGSSGVGCIIEFWKIGKAMHIEIDRTGRIPMLRFRDRDSYAQNKTKEYDDIAMKYLSYVLFLLVAGSSVYSLMYERHKSWYSWILSSLTSCVYMFGFIMMCPQLFINYKLKSVAHMPWRQMTYKFLNTIIDDLFAFVIKMPTLHRLSVFRDDIIFLIYLYQKWAYPVDKKRVNEFGFGGEDDTAVASTQVDAAAKEEEKKTN*
• ORF Type: complete

Annotations of Ll_transcript_297480

• Blastp: CLPTM1-like membrane protein cnrB from Dictyostelium with 60.45% of identity
• Blastx: CLPTM1-like membrane protein cnrB from Dictyostelium with 52.17% of identity
• Eggnog: cleft lip and palate(ENOG410XPEV)
• Kegg: Link to kegg annotations (DDB_G0283115)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432410.1)
• Pfam: Cleft lip and palate transmembrane protein 1 (CLPTM1) (PF05602.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;