Transcript | Ll_transcript_297483 |
---|---|
CDS coordinates | 2124-2762 (+) |
Peptide sequence | MAVSLLHSVFDFLAFKNDIQFWNKNKSMEGLSAKTILVSFICQLIIFLYLLDNDTSWMILASSGIGCIIEFWKIGKAMRIEIDRTGRIPMLRLRDRESYVRNKTKEYDDIAMKYLSYVLFLLVVGLSIYSLMYERHKSWYSWILSSLTSCVYMFGFIMMCPQLFINYKLKSVAHLPWRQMTYKFLNTIIDDLFAFVIKMPTLHRLSVFCDDLI |
ORF Type | 3prime_partial |
Blastp | CLPTM1-like membrane protein cnrB from Dictyostelium with 64.95% of identity |
---|---|
Blastx | CLPTM1-like membrane protein cnrB from Dictyostelium with 61.64% of identity |
Eggnog | cleft lip and palate(ENOG410XPEV) |
Kegg | Link to kegg annotations (DDB_G0283115) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433905.1) |
Pfam | Cleft lip and palate transmembrane protein 1 (CLPTM1) (PF05602.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer