Protein coding transcript 109904

• Transcript: Ll_transcript_295875
• CDS coordinates: 2200-3261 (+)
• Peptide sequence: MVLTAGRQLAKSLELQSLNELGLSKRYVRFLQISEVVNSMKDLIDICKEHKVGPTESLKNYPQFATAAKLQMHGIEQLANVQGLPTDRNTLNKLMTLNPGLNNQVNNNHNMVNCGALSGSAQAALELSNYQNILMRQNSTNSSPGPIQREGSSFNQVSQSPSSSLQGTATALIPGSMQNSTSRGFPSPNHLPPRLQHPQLQQRSLSANSLPIQNYSQGSQGNQAIQQQFIQQLLQDMSNNNNGGVQPQSVVGGPNANGNNMSKNGLGFGGHTPSMSGSSALVSGNSEPVSMSNSFKAVSNSGSSAAADGNNGFYQRTSDMPQNQQIQDIAHDFTENSFFNNDLDDNMGFGWKP*
• ORF Type: complete

Annotations of Ll_transcript_295875

• Blastp: Probable transcriptional regulator SLK2 from Arabidopsis with 42.03% of identity
• Blastx: Probable transcriptional regulator SLK2 from Arabidopsis with 76.77% of identity
• Eggnog: NA(ENOG41126CV)
• Kegg: Link to kegg annotations (AT5G62090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431317.1)
• Pfam: LIM-domain binding protein (PF01803.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;