Transcript | Ll_transcript_295880 |
---|---|
CDS coordinates | 2200-3273 (+) |
Peptide sequence | MVLTAGRQLAKSLELQSLNELGLSKRYVRFLQISEVVNSMKDLIDICKEHKVGPTESLKNYPQFATAAKLQMHGIEQLANVQGLPTDRNTLNKLMTLNPGLNNQVNNNHNMVNCGALSGSAQAALELSNYQNILMRQNSTNSSPGPIQREGSSFNQVSQSPSSSLQGTATALIPGSMQNSTSRGFPSPNHLPPRLQHPQLQQRSLSANSLPIQNYSQGSQGNQAIQQQFIQQLLQDMSNNNNGGVQPQSVVGGPSANVNNMSNNGLGFGCHTPSISGSSALVSGNSEPVSRSDSFKAISNSESSAPADGNNGFNQRTSTMPQNQHMQDMVPDIAHEFTENSFFNNDLDDNMGFGWKQ* |
ORF Type | complete |
Blastp | Probable transcriptional regulator SLK2 from Arabidopsis with 41.64% of identity |
---|---|
Blastx | Probable transcriptional regulator SLK2 from Arabidopsis with 76.77% of identity |
Eggnog | NA(ENOG41126CV) |
Kegg | Link to kegg annotations (AT5G62090) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431317.1) |
Pfam | LIM-domain binding protein (PF01803.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer