Protein coding transcript 109910

• Transcript: Ll_transcript_295865
• CDS coordinates: 531-1034 (+)
• Peptide sequence: MSTFWIWLTEATFEVLPRLNEIKFGSGVIDELLFLDMPREYRFQSGMLMLEYAKAVQESVYEQLRVSREGHLRIIFTQDLKILSWEFCARRHEELLPRRSVVPQVNQLVQVAEKCQSTIAESGADGVSQQDLQANSDMVLTAGRQLAKSLELQSLNELGFPKRYVRFL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_295865

• Blastp: Probable transcriptional regulator SLK1 from Arabidopsis with 77.36% of identity
• Blastx: Probable transcriptional regulator SLK1 from Arabidopsis with 77.36% of identity
• Eggnog: NA(ENOG41126CV)
• Kegg: Link to kegg annotations (AT4G25520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431315.1)
• Pfam: LIM-domain binding protein (PF01803.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;