Transcript | Ll_transcript_295867 |
---|---|
CDS coordinates | 35-1126 (+) |
Peptide sequence | MDAWQCDMCGSKSGKGFEATFEVLPRLNEIKFGSGVIDELLFLDLPREYRFQSGVMMLEYAKAVQETVYEQLRVSREGHLRIIFTQDLKILSWEFCARRHEELLPRRLVVPQVNQLVQVAQKWQSTIAESGSDGVSQQDLQANSNMVLTAGRQLAKSLELQSLNELGFPKRYVRFLQISEVVNSMKDLIDICKEYKVGPIESLKNYPQFPTSAKHQMHETERLANVQALPTDQNTHNKLMALNPGFNNQVNNNHNMVNCGALSGSTQTALELSNYQNILMRQNSMNSSPGPLQREGSSVNKLNQSPSSSLQGTATALIPGSMQNSTSRGFPSPHHLPPRLQHPQLQQRSLSANSLPIQNYSQGS |
ORF Type | 3prime_partial |
Blastp | Probable transcriptional regulator SLK2 from Arabidopsis with 63.29% of identity |
---|---|
Blastx | Probable transcriptional regulator SLK2 from Arabidopsis with 65.36% of identity |
Eggnog | NA(ENOG41126CV) |
Kegg | Link to kegg annotations (AT5G62090) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431316.1) |
Pfam | LIM-domain binding protein (PF01803.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer