Protein coding transcript 10992

• Transcript: Ll_transcript_335471
• CDS coordinates: 2-391 (+)
• Peptide sequence: PHGIDCHENVVKECEEEAGIPRPISIKAIPVGAVSYMDIDEYRYKRDVLFCYDLKLPESFVPKNEDGEVDSFKLIPVVQVAEVIRKTQFFKPNCSLVIIDFLFRHGYYSLFSTFSRHFPGISLFININS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_335471

• Blastp: Nudix hydrolase 20, chloroplastic from Arabidopsis with 77.57% of identity
• Blastx: Nudix hydrolase 20, chloroplastic from Arabidopsis with 77.57% of identity
• Eggnog: Nudix hydrolase(COG0494)
• Kegg: Link to kegg annotations (AT5G19460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458672.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;