Transcript | Ll_transcript_335475 |
---|---|
CDS coordinates | 386-736 (+) |
Peptide sequence | MLKTYEERTSAVGYVVERLGEERIPGIRNELYPVTSSFGAPIFFSLERAAAPYFGIKAYGIHMNGYVELDGQKHLWIAKRSSTKPTYPGMLDHLVAGGLVCSFIFTFVSKVGQLNA* |
ORF Type | complete |
Blastp | Nudix hydrolase 20, chloroplastic from Arabidopsis with 74% of identity |
---|---|
Blastx | Nudix hydrolase 20, chloroplastic from Arabidopsis with 75% of identity |
Eggnog | Nudix hydrolase(COG0494) |
Kegg | Link to kegg annotations (AT5G19460) |
CantataDB | Link to cantataDB annotations (CNT0000325) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458672.1) |
Pfam | Domain of unknown function (DUF4743) (PF15916.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer