Transcript | Ll_transcript_297550 |
---|---|
CDS coordinates | 2998-3930 (+) |
Peptide sequence | MYDGVDEGYDSSRDDISSVSSYNHLKGNLLRGFGSSPSLRSSSTRSLNRDTSALEGRRTSLSSNMALPRLSAAEVLSDSGPDILSTQKSFGIVSPSEQQKLRKPFSPDGAGGSSSPEAGAIESLASEGFIRGRSYNIRLDDQVLLKYSPRNSDSTYYFSDMIGGTLTFFHEEGARRCLEISITLETSETINRRFVHPSRRNSPTITKVLSDHHEVVADLVQTSFLFSIPMDGPMSFSTAHVSVQWVLRFEFFTTPKHVDWKKYEHPLLIEGRDKTEWVLPITVHALPPRTPASGTRNEKLFSLDPMWVHN* |
ORF Type | complete |
Blastp | RAB6A-GEF complex partner protein 2 from Homo with 30.41% of identity |
---|---|
Blastx | RAB6A-GEF complex partner protein 2 from Homo with 30.41% of identity |
Eggnog | RGP1 retrograde golgi transport homolog (S. cerevisiae)(ENOG410YESN) |
Kegg | Link to kegg annotations (9827) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449629.1) |
Pfam | Rgp1 (PF08737.9) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer