| Transcript | Ll_transcript_335173 |
|---|---|
| CDS coordinates | 3-302 (+) |
| Peptide sequence | RIRFNKDGALLAVSANENGIKILANGDGIHLLRSLENSLYDASRTSEAIAKPTINPISAVAAAATSAALAERASSVAAIAGMVRLSRIHINRICYFLKF* |
| ORF Type | 5prime_partial |
| Blastp | Protein TPR3 from Oryza sativa with 58.62% of identity |
|---|---|
| Blastx | Protein TPR3 from Oryza sativa with 65.52% of identity |
| Eggnog | CTLH(ENOG41101DA) |
| Kegg | Link to kegg annotations (4332285) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019436340.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer