Protein coding transcript 11007

• Transcript: Ll_transcript_335174
• CDS coordinates: 3-350 (+)
• Peptide sequence: RIRFNKDGALLAVSANENGIKILANGDGIHLLRSLENSLYDASRTSEAIAKPTINPISAVAAAATSAALAERASSVAAIAGMNGDTRTLGDVQPRISEESNDKSKIWKLTEINEPS
• ORF Type: internal

Annotations of Ll_transcript_335174

• Blastp: Protein TOPLESS from Arabidopsis with 60.68% of identity
• Blastx: Protein TPR3 from Oryza sativa with 59.17% of identity
• Eggnog: Positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein- mediated microtubule sliding by targeting dynein to the microtubule plus end. Required for(ENOG410XP3K)
• Kegg: Link to kegg annotations (AT1G15750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457960.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;