Transcript | Ll_transcript_295398 |
---|---|
CDS coordinates | 288-716 (+) |
Peptide sequence | MMNSQYCSGYMAPEYAMHGYLTDKVDVYSFGIVALEIVSGMSNTINQLTEECFSLLDWVHVLKEKGNLMELVDKRLGGEFNKEEAMLIIKVSLLCTNFSPMLRPAMSSVVNMLEGRSVVHEVSDTSEALDDKKFEMMKQYYQ* |
ORF Type | complete |
Blastp | Probable LRR receptor-like serine/threonine-protein kinase At1g07650 from Arabidopsis with 54.48% of identity |
---|---|
Blastx | Probable LRR receptor-like serine/threonine-protein kinase At1g53420 from Arabidopsis with 54.67% of identity |
Eggnog | leucine Rich Repeat(COG4886) |
Kegg | Link to kegg annotations (AT1G07650) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449222.1) |
Pfam | Protein tyrosine kinase (PF07714.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer