Protein coding transcript 110148

• Transcript: Ll_transcript_295410
• CDS coordinates: 341-1222 (+)
• Peptide sequence: MPGNLFTRRVTCDCKFDNHTVCHVTSIVLRGLNISGAIPSELGRLPYLTELDLSRNHFNGSIPKSLGGLPLVNLELLGNRLSGPIPAEIGDIASLEFLILEDNQLSGPLPPSLGNLSDLLELLLSGNNLTGTIPEEFGKLKNLTDFRVDGNNLSGKIPSFIGNWTHLLRLDMQGTSMEGPIPATISSLTKLKELRISDLKAPTPFPDLKELKTLNRLVLRNCLMTGPIPDFVGELSMLKVLDLSFNRLSGLIPDSFQGLRRINYMFLTNNSLTGTVPGWLQESRHNIDLSYNNF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_295410

• Blastp: Probable LRR receptor-like serine/threonine-protein kinase At1g53440 from Arabidopsis with 58.28% of identity
• Blastx: Probable LRR receptor-like serine/threonine-protein kinase At1g53440 from Arabidopsis with 54.1% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT1G53440)
• CantataDB: Link to cantataDB annotations (CNT0000418)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020982491.1)
• Pfam: Leucine Rich repeat (PF13516.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;