Protein coding transcript 110150

• Transcript: Ll_transcript_295412
• CDS coordinates: 1252-1746 (+)
• Peptide sequence: MQGTSMEGPIPATISSLTKLKELRISDLKAPTPFPDLKELKTLNRLVLRNCLMTGPIPDFVGELSMLKVLDLSFNRLSGLIPDSFQGLRRINYMFLTNNSLTGTVPGWLQESRHNMLGYFFDFFLHLFPDAYFRVTCSNLTVTQVHHILVIKLEHSLSNVEIKI*
• ORF Type: complete

Annotations of Ll_transcript_295412

• Blastp: Probable LRR receptor-like serine/threonine-protein kinase At1g53440 from Arabidopsis with 57.63% of identity
• Blastx: Probable LRR receptor-like serine/threonine-protein kinase At1g53430 from Arabidopsis with 60.5% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT1G53440)
• CantataDB: Link to cantataDB annotations (CNT0000418)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443853.1)
• Pfam: Leucine rich repeat (PF13855.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;