Protein coding transcript 110151

• Transcript: Ll_transcript_295413
• CDS coordinates: 104-472 (+)
• Peptide sequence: MLFVMSTCKYISLFIFVLVYFNYLYHFGSNAQLIPRQEVKILQKISDKVQNLNWKVTERSCSGDEGFGNKYMPGNLFTRRVTCDCKFDNHTVCHVTSIVLRGLNISGAIPSELGRLPYLTEL*
• ORF Type: complete

Annotations of Ll_transcript_295413

• Blastp: Probable LRR receptor-like serine/threonine-protein kinase At1g53440 from Arabidopsis with 40.98% of identity
• Blastx: Probable LRR receptor-like serine/threonine-protein kinase At1g53440 from Arabidopsis with 40.48% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT1G53440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004488999.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;