Protein coding transcript 1102

• Transcript: Ll_transcript_452110
• CDS coordinates: 1-321 (+)
• Peptide sequence: NVDEIFTSVKVWLSGAVTYQDTCLDGFENTTSEASKKMKDLLTTSMHMSSNALAIITNMADTIADWNVTRLLGGRRLLEESKNENSFNLPTWVADDAGVHKLLAETP
• ORF Type: internal

Annotations of Ll_transcript_452110

• Blastp: Probable pectinesterase/pectinesterase inhibitor 58 from Arabidopsis with 33.94% of identity
• Blastx: Probable pectinesterase/pectinesterase inhibitor 58 from Arabidopsis with 32.69% of identity
• Eggnog: pectinesterase(COG4677)
• Kegg: Link to kegg annotations (AT5G49180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451202.1)
• Pfam: Plant invertase/pectin methylesterase inhibitor (PF04043.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;