Protein coding transcript 110206

• Transcript: Ll_transcript_296394
• CDS coordinates: 2-313 (+)
• Peptide sequence: ERLDCKKDSEIWEKDENILQLRHWASLRGQTLSRTVRGMMYYRRALKLQAFLDMANEKEILDGYKAITVPSEEEKKSHRSLYASLEAIADMKFTYVATCQNYGN
• ORF Type: internal

Annotations of Ll_transcript_296394

• Blastp: Callose synthase 5 from Arabidopsis with 79.81% of identity
• Blastx: Callose synthase 5 from Arabidopsis with 79.81% of identity
• Eggnog: synthase(ENOG410XQ8V)
• Kegg: Link to kegg annotations (AT2G13680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437222.1)
• Pfam: 1,3-beta-glucan synthase component (PF02364.14)
• Rfam: snoJ33 (RF00315)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;