Protein coding transcript 110277

• Transcript: Ll_transcript_296359
• CDS coordinates: 234-926 (+)
• Peptide sequence: MKHKDGKPINLPNKNRKVTLAITAIVLCGLSFYLGGMQCNTKNDGVVTNTNDNDNDNGIDLPKQNLGSLQVRPINFPECSIDLQDYTPCTDPRRWRKYGTYRLTLLERHCPPLSERKECLVPSPDGYKPPIRWPKSRDECWYRNVPYDWINNEKSNQHWLRKEGEKFLFPGGGTMFPNGVGEYVDLMVDLIPEMKDGTVRTAIDTGCGVSFPNSNENCCSSQHSFLNIIY*
• ORF Type: complete

Annotations of Ll_transcript_296359

• Blastp: Probable methyltransferase PMT21 from Arabidopsis with 65.24% of identity
• Blastx: Probable methyltransferase PMT21 from Arabidopsis with 64.29% of identity
• Eggnog: Methyltransferase(ENOG4111CGI)
• Kegg: Link to kegg annotations (AT4G19120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423377.1)
• Pfam: Putative S-adenosyl-L-methionine-dependent methyltransferase (PF03141.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;