Transcript | Ll_transcript_294919 |
---|---|
CDS coordinates | 412-1527 (+) |
Peptide sequence | MLVYIRDSDKEKIICSVDEKDVAQHVRVRLQKEQEEKEQKRKEKEEAHLYTVIKVARDADLHKQIGKDIFFDLVDHDKVQSFRIRKQTPFITFKEEVAREFGVPVIYQRFWLWAKRQNNTYRPNRPLTPQEESQSVGQLRDVYNKANNAELKLFMEVEQDFGPIPLPGKRKEDLLLFFKLYDPSNETLRYIGRLHVTSSGKPVDILTKLNEMAGFALDEEIELFEEIKSEPHVMCEHVDNNVTFHANQLEDGDIICIQKTQVGSDEQIRYPDVPSFLEYVHNRQVVRFRYLEKPKEDVFSLELSKIHTYDDVVIGVAEHLGLDDPSKIRLTSHNCYSQQPRPQPIKYRGVEHLSDMLTNCNQVLVPRSQFY* |
ORF Type | complete |
Blastp | Ubiquitin carboxyl-terminal hydrolase 12 from Arabidopsis with 74.18% of identity |
---|---|
Blastx | Ubiquitin carboxyl-terminal hydrolase 12 from Arabidopsis with 77.05% of identity |
Eggnog | ubiquitin carboxyl-terminal hydrolase(COG5077) |
Kegg | Link to kegg annotations (AT5G06600) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427989.1) |
Pfam | ICP0-binding domain of Ubiquitin-specific protease 7 (PF12436.7) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer