Protein coding transcript 110301

• Transcript: Ll_transcript_294909
• CDS coordinates: 628-1128 (+)
• Peptide sequence: MLTNCNQTSDILYYEALDIPLPELQCLKTLKIAFHNATKDEVVIHTIRLPKQSAVEDVINDLKSKVDLSHPGAELRLLEILYHKIYKVFSLNDMIDNINDQYWTLRAEEVPADEINLSPRDRLIHVYHFMKDTAQNQQVQNFGDPFFLVIHEGETLADIKLRIQKKL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_294909

• Blastp: Ubiquitin carboxyl-terminal hydrolase 12 from Arabidopsis with 76.65% of identity
• Blastx: Ubiquitin carboxyl-terminal hydrolase 13 from Arabidopsis with 78.08% of identity
• Eggnog: ubiquitin carboxyl-terminal hydrolase(COG5077)
• Kegg: Link to kegg annotations (AT5G06600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427991.1)
• Pfam: Ubiquitin-specific protease C-terminal (PF14533.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;