Protein coding transcript 110304

• Transcript: Ll_transcript_294856
• CDS coordinates: 357-710 (+)
• Peptide sequence: MVQGSFDMLPDHKVTNLGNFIVNDHDSTPSPMNTSVDKGRADSKALDTVPEMGDDELAMVSVLQKSKRSEIVQRRIRRPFSVEEVEALVHAVEKLGTGRWRDVKTRAFGNAKHRTYVD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_294856

• Blastp: Telomere repeat-binding protein 3 from Arabidopsis with 57% of identity
• Blastx: Telomere repeat-binding protein 3 from Arabidopsis with 49.28% of identity
• Eggnog: Telomere repeat-binding protein(ENOG4111C5T)
• Kegg: Link to kegg annotations (AT3G12560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448621.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;