Transcript | Ll_transcript_294656 |
---|---|
CDS coordinates | 188-646 (+) |
Peptide sequence | MPSLVDLQGTPTSDGVTWEAVLVNRAADSNLLKLERKALELAEELKTDFEVVINSNLVIKIAILVSEYMGGPVEDPASMTRAWRSLCYSLKATLGSMVLPLGSLTIGLARHRALLFKVLADRLGIPCRLVKGLQYTGSDDVAMNFVRINDGR* |
ORF Type | complete |
Blastp | Probable serine/threonine-protein kinase SIS8 from Arabidopsis with 71.24% of identity |
---|---|
Blastx | Probable serine/threonine-protein kinase SIS8 from Arabidopsis with 67.86% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT1G73660) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446149.1) |
Pfam | Ethylene-responsive protein kinase Le-CTR1 (PF14381.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer