Protein coding transcript 110347

• Transcript: Ll_transcript_294656
• CDS coordinates: 188-646 (+)
• Peptide sequence: MPSLVDLQGTPTSDGVTWEAVLVNRAADSNLLKLERKALELAEELKTDFEVVINSNLVIKIAILVSEYMGGPVEDPASMTRAWRSLCYSLKATLGSMVLPLGSLTIGLARHRALLFKVLADRLGIPCRLVKGLQYTGSDDVAMNFVRINDGR*
• ORF Type: complete

Annotations of Ll_transcript_294656

• Blastp: Probable serine/threonine-protein kinase SIS8 from Arabidopsis with 71.24% of identity
• Blastx: Probable serine/threonine-protein kinase SIS8 from Arabidopsis with 67.86% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G73660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446149.1)
• Pfam: Ethylene-responsive protein kinase Le-CTR1 (PF14381.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;