Protein coding transcript 110360

• Transcript: Ll_transcript_295291
• CDS coordinates: 353-853 (+)
• Peptide sequence: MEVITDAASFDAELLQLPEFSSPALKSNLNFVDKIFDQWLSLPETVRSVTSLLNEAKSGAPLNVPGNCSSPNAASSSLPSMFPAGTAPPLSPRSTSGSPRIVKQRAGLSNLSSPLKVVSEPVKEVIPQFYFQHGRPPPNDLKEKCLFKIDHLFHDHLDGLQKHGEI*
• ORF Type: complete

Annotations of Ll_transcript_295291

• Blastp: Probable serine/threonine protein phosphatase 2A regulatory subunit B''delta from Arabidopsis with 62.8% of identity
• Blastx: Probable serine/threonine protein phosphatase 2A regulatory subunit B''delta from Arabidopsis with 62.8% of identity
• Eggnog: Protein phosphatase 2, regulatory subunit B(ENOG410XRBK)
• Kegg: Link to kegg annotations (AT1G54450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439906.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;