Protein coding transcript 110370

• Transcript: Ll_transcript_295281
• CDS coordinates: 431-1279 (+)
• Peptide sequence: MDFVTDAASFDAELLQLPEFSSSALKSNIDFAEKVFDQWLSLPESVRSVTSLLNEAKSGAPLNVPGNCSSPNAASNSLPSMFPAGTAPPLSPRSTSGSPRIVKQRAGLSNLGSPLKVVSEPVKEVIPQFYFQHGRPPPNDLKEKCLFKIDHLFHDHLDGLQIHEFKSVTKELCKLPSFFSTSLFRKIDNGTGLVTRKAFIDYWINGKMLTMDIATQIYTILKQPQLKYLTQDDFKPVLRELLSTHPGLEFLQSTPEFQERYGLHFLDITLCFRGSCNRKLRK*
• ORF Type: complete

Annotations of Ll_transcript_295281

• Blastp: Serine/threonine protein phosphatase 2A regulatory subunit B''beta from Arabidopsis with 67.44% of identity
• Blastx: Serine/threonine protein phosphatase 2A regulatory subunit B''beta from Arabidopsis with 66.67% of identity
• Eggnog: Protein phosphatase 2, regulatory subunit B(ENOG410XRBK)
• Kegg: Link to kegg annotations (AT5G28850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428390.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;