Protein coding transcript 110414

• Transcript: Ll_transcript_296816
• CDS coordinates: 65-979 (+)
• Peptide sequence: MDHLDERVEAISHSKPTSNWSIHISYIRTVKVSNISLVTPKKDIGEFFSFSGDIQYIEMHRETDRTQIAYVTFKDSQGAETAVLLTGSKIGDLYVTIALEENYQLPPEALPRSPANQTAVAVQKAEDVMSTMLAKGFILGKDAVNKAKTFDERHHLSLNASSTVASIDQKIGLSDKLSIGTAIVNEKVREMDEKFQVFERTKSAIAVAEQKASIAGSAIMSNPYVLTGASWMSSAFSAIAKAAGDVSMKTKEKVEQAELEKKEIIYNERKETIDEFGRIHFESSDVGPAVVPVNSGDDKKLEII*
• ORF Type: complete

Annotations of Ll_transcript_296816

• Blastp: Binding partner of ACD11 1 from Arabidopsis with 56.65% of identity
• Blastx: Binding partner of ACD11 1 from Arabidopsis with 56.65% of identity
• Eggnog: actin cytoskeleton protein(ENOG4111ICI)
• Kegg: Link to kegg annotations (AT5G16840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420195.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;