Protein coding transcript 110416

• Transcript: Ll_transcript_296820
• CDS coordinates: 340-870 (+)
• Peptide sequence: MSTMLAKGFILGKDAVNKAKTFDERHHLSLNASSTVASIDQKIGLSDKLSIGTAIVNEKVREMDEKFQVFERTKSAIAVAEQKASIAGSAIMSNPYVLTGASWMSSAFSAIAKAAGDVSMKTKEKVEQAELEKKEIIYNERKETIDEFGRIHFESSDVGPAVVPVNSGDDKKLEII*
• ORF Type: complete

Annotations of Ll_transcript_296820

• Blastp: Binding partner of ACD11 1 from Arabidopsis with 63.78% of identity
• Blastx: Binding partner of ACD11 1 from Arabidopsis with 58.05% of identity
• Eggnog: actin cytoskeleton protein(ENOG4111ICI)
• Kegg: Link to kegg annotations (AT5G16840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420198.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;