Protein coding transcript 110420

• Transcript: Ll_transcript_297430
• CDS coordinates: 147-500 (+)
• Peptide sequence: MYRMMWGYFFPGEERDSQRRQEVWKVSTTAGARRVKKGSSVHEASASSSHSKKESEASSKSSFTSMLFPSSSQPSVPADSARASKAQNTKPNPGTGSTSELRRTSSFDRTWEETVAES
• ORF Type: 3prime_partial

Annotations of Ll_transcript_297430

• Blastp: Protein SABRE from Arabidopsis with 53.85% of identity
• Blastx: Protein KINKY POLLEN from Arabidopsis with 51.88% of identity
• Eggnog: UPF0378 protein(ENOG410XSYR)
• Kegg: Link to kegg annotations (AT1G58250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460713.1)
• Pfam: Golgi-body localisation protein domain (PF10351.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;