| Transcript | Ll_transcript_297436 |
|---|---|
| CDS coordinates | 2-361 (+) |
| Peptide sequence | SDTLYFPDLSFLTLYGYEVNVFLLYGHRGVGIIIKDVDISSGEVTVSLNDGLFLKSKSSSESSSGSGRILESSADSVSTKKTSKQQQSLAAFSKYSSMFPEKVVNLNLLPVYHHNYPHI* |
| ORF Type | 5prime_partial |
| Blastp | Protein SABRE from Arabidopsis with 41.84% of identity |
|---|---|
| Blastx | Protein SABRE from Arabidopsis with 41.84% of identity |
| Eggnog | UPF0378 protein(ENOG410XSYR) |
| Kegg | Link to kegg annotations (AT1G58250) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019416694.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer