Protein coding transcript 110427

• Transcript: Ll_transcript_297440
• CDS coordinates: 333-917 (+)
• Peptide sequence: MIAGGRSMLVQGLKRELVSAQKSRKAASASLRLALQKAAHLRLMEKEKNKSPSYAMRISLQINKVVWSMLVDGKSFAEAEINDMIYDFDRDYKDVGVAQFTTKYFVVRNCLPNAKSDMLLSAWNPPPEWGKKVMLRVDAKQGAPKDGNSPLELFQVEIYPLKIHLTETMYRMMWEYFFPEEEQDSQRRQEVWKVS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_297440

• Blastp: Protein SABRE from Arabidopsis with 89.74% of identity
• Blastx: Protein SABRE from Arabidopsis with 86.08% of identity
• Eggnog: UPF0378 protein(ENOG410XSYR)
• Kegg: Link to kegg annotations (AT1G58250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416695.1)
• Pfam: Golgi-body localisation protein domain (PF10351.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;