| Transcript | Ll_transcript_296728 |
|---|---|
| CDS coordinates | 34-303 (+) |
| Peptide sequence | MACRDIENTLQALTGASLGEGSGATMSDDEDDMRMDLSLDQSSGEGHDMMGFGPLLPTESERSLMERVRQELKIELKQVHSYEMCHSLF* |
| ORF Type | complete |
| Blastp | Homeobox protein HD1 from Brassica with 76.54% of identity |
|---|---|
| Blastx | Homeobox protein HD1 from Brassica with 92.22% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (106394496) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019424063.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer