Transcript | Ll_transcript_296247 |
---|---|
CDS coordinates | 1730-2920 (+) |
Peptide sequence | MGLQHPRPIPALGSAPGYINRMYSNKLYNQYGNTVRSSIGYGTHGYESRTNGRGWLAVDNKYKSRGRSGGYFGYGNDNTDGLNELNRGPRAKSNKNQKGFAPTILAVKGQNLPAALSTSEEKDKTISVPDLDQYNNVEFPEEYTDAKFFIIKSYSEDDVHKSIKYNVWASTQNGNKKLDAAYQEAQQKPGGCPVFLFFSVNTSGQFVGLAEMIGPVDFNSSVEYWQQDKWNGCFPLKWHIVKDVPNNLLRHITLENNESKPVTNSRDTQEVLLEPGLKLIKIFKEFSSKTCILDDFAFYEARQKTILEKKAKQQVPKQAWEGKPTDEKAELNEEVKAQNPEVAAELLKDLTLSEKDTDDHKLSKNESDAKTGDAPKGAKPVVSGTKIVTNVVANGS* |
ORF Type | complete |
Blastp | YTH domain-containing family protein 2 from Macaca with 51.27% of identity |
---|---|
Blastx | YTH domain-containing family protein 2 from Mus with 51.27% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444219.1) |
Pfam | YT521-B-like domain (PF04146.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer