Protein coding transcript 110574

• Transcript: Ll_transcript_296240
• CDS coordinates: 1-849 (+)
• Peptide sequence: MCIVFQLFYCFFCYIACASMRIGCLFHQSIILYCSNNLNSLHCFFFLWQGLQHPRPIPALGSAPGYINRMYSNKLYNQYGNTVRSSIGYGTHGYESRTNGRGWLAVDNKYKSRGRSGGYFGYGNDNTDGLNELNRGPRAKSNKNQKGFAPTILAVKGQNLPAALSTSEEKDKTISVPDLDQYNNVEFPEEYTDAKFFIIKSYSEDDVHKSIKYNVWASTQNGNKKLDAAYQEAQQKPGGCPVFLFFSVNTSGQFVGLAEMIGPVDFNSSVEYWQQDKWNGCFP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_296240

• Blastp: YTH domain-containing family protein 2 from Danio with 45.59% of identity
• Blastx: YTH domain-containing family protein 2 from Danio with 45.59% of identity
• Eggnog: YTH domain family(ENOG410YABQ)
• Kegg: Link to kegg annotations (393220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444219.1)
• Pfam: YT521-B-like domain (PF04146.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;