Protein coding transcript 1106

• Transcript: Ll_transcript_452108
• CDS coordinates: 166-579 (+)
• Peptide sequence: MIKHQHHGLKIGTILIMMLSLACTFGVSSSSSNNLHPLILIPGNGGNQLEAKLTSEYKACNWFCERWYPLVKKKDGWFRLWFDSTVLLAPFTQCFADRMKLHYDTHRDDYYNTPGVHTRVPQFGSTYSLLYLNPRLK*
• ORF Type: complete

Annotations of Ll_transcript_452108

• Blastp: Lecithin-cholesterol acyltransferase-like 1 from Arabidopsis with 54.14% of identity
• Blastx: Lecithin-cholesterol acyltransferase-like 1 from Arabidopsis with 54.14% of identity
• Eggnog: Acyl-transferase(ENOG410Y9CF)
• Kegg: Link to kegg annotations (AT1G27480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417729.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;