Transcript | Ll_transcript_452108 |
---|---|
CDS coordinates | 166-579 (+) |
Peptide sequence | MIKHQHHGLKIGTILIMMLSLACTFGVSSSSSNNLHPLILIPGNGGNQLEAKLTSEYKACNWFCERWYPLVKKKDGWFRLWFDSTVLLAPFTQCFADRMKLHYDTHRDDYYNTPGVHTRVPQFGSTYSLLYLNPRLK* |
ORF Type | complete |
Blastp | Lecithin-cholesterol acyltransferase-like 1 from Arabidopsis with 54.14% of identity |
---|---|
Blastx | Lecithin-cholesterol acyltransferase-like 1 from Arabidopsis with 54.14% of identity |
Eggnog | Acyl-transferase(ENOG410Y9CF) |
Kegg | Link to kegg annotations (AT1G27480) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417729.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer