Protein coding transcript 110638

• Transcript: Ll_transcript_295273
• CDS coordinates: 167-673 (+)
• Peptide sequence: MMMLLMETPIHPLLPCLVQFASMLLLIMEIDLGLSFNVAINFILRFDELLHMQMVSHIPRMIVARVSSFLLKLTEANYFGRHIYGTQLDCIGSAFNVKGAMQCPNCRKIEKGQWLYANGCRSYPEFSMDDWTHDEDVYDFSYSEMSFGVHWCPFSNLTQLPSSFEDGEF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_295273

• Blastp: E3 ubiquitin-protein ligase RFI2 from Arabidopsis with 67.9% of identity
• Blastx: E3 ubiquitin-protein ligase RFI2 from Arabidopsis with 67.9% of identity
• Eggnog: zinc finger, C3HC4 type domain containing protein, expressed(ENOG410Y9QY)
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0001974)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418867.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;