Protein coding transcript 110667

• Transcript: Ll_transcript_294668
• CDS coordinates: 353-829 (+)
• Peptide sequence: MFHWCLVSVVCVLTFCSIYGSIMHFIIQVNAFRERRALALTLNDTKTAVNKLHRMLNFLVILLIVIIWLLILQIASTKLFLFVSSQVVLVAFIFGNSCKTVFESIIFLFVLHPFDVGDRCEIDGVQMVVEEMNILTTIFLRYDNQKILIPNSVLATKAI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_294668

• Blastp: Mechanosensitive ion channel protein 8 from Arabidopsis with 76.34% of identity
• Blastx: Mechanosensitive ion channel protein 4 from Arabidopsis with 75.57% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT2G17010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014628157.1)
• Pfam: Mechanosensitive ion channel (PF00924.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;