Transcript | Ll_transcript_296165 |
---|---|
CDS coordinates | 1631-2545 (+) |
Peptide sequence | MLGTTVLIPTALVPQMGGGNEEKAQVIQTLLFVAGINTLLQSLFGTRLPAVIGGSYTFVPTTISIILAGRFSDEADPIEKFKRIMRAIQGALIVASTLQIVLGFSGLWRNVARFLSPLSAVPLVSLVGFGLYELGFPGVAKCVEIGLPELILVVFVSQYVPHVLHSGKHIFDRFAVIFTVAIVWIYAHLLTVGGAYNNAAPKTKVSCRTDRAGLIDAAPWIRVPYPFQWGAPSFDAGEAFAMMMAAFVALVEVTFSSDLPFFLLSWNNYSITFYNWGWYVFNVHYSFTKYMKTLLGLSGMYTCV* |
ORF Type | complete |
Blastp | Nucleobase-ascorbate transporter 6 from Arabidopsis with 84.25% of identity |
---|---|
Blastx | Nucleobase-ascorbate transporter 6 from Arabidopsis with 83.97% of identity |
Eggnog | permease(COG2233) |
Kegg | Link to kegg annotations (AT5G62890) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456774.1) |
Pfam | Permease family (PF00860.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer