Protein coding transcript 11083

• Transcript: Ll_transcript_335125
• CDS coordinates: 146-1477 (+)
• Peptide sequence: MDVEMDTSPHLFDPHNLSTREKFRRYGKRHSSSGASAHENSASKLSETGLFYDGQNIHSPTNAALFLENIKQEVDDFEEKTPYSSRKRLSADIPGVPGVDAGFDSVRHSLKACKQEGDSLGDGAESIFTLFASLLDSSLQGLMPFPDLILRFEDACRNVSESTRYGLNLRHRVVEDKLMRQKAQFLLDEAATWSLLWFLYGKVTEELSKDQILVSETSHVVACEFVAEDHTAQLSLRIVQWLEGLASKALDLEAKVRGSHVGSYLPSSGVWHHTQRYLKKGASDMNVVHHLDFDAPTRENANILPDDKKQDESLLEDLWTLLRAGRLEEACGLCRSAGQPWRAASLCPFGDLNQFPSIDTLVKNGKNRTLQAVEFESGIGHQWHLWKWASYCASEKMAELGGKYEAAVYAAQCSNLKQMLPLCTDWEVYFPPTIAKNIEKMLS*
• ORF Type: complete

Annotations of Ll_transcript_335125

• Blastp: Nuclear pore complex protein NUP107 from Arabidopsis with 64.22% of identity
• Blastx: Nuclear pore complex protein NUP107 from Arabidopsis with 64.22% of identity
• Eggnog: nuclear pore complex protein(ENOG410XRUG)
• Kegg: Link to kegg annotations (AT3G14120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460751.1)
• Pfam: Nuclear pore protein 84 / 107 (PF04121.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;