Protein coding transcript 11084

• Transcript: Ll_transcript_335126
• CDS coordinates: 562-1188 (+)
• Peptide sequence: MFFKVGLSWWGSFQLLGINLPKFFVLSHRPHGDPQMIRFGAHLVLVLRYLLAEQMKDTFRDKILSVGDNILHVYALFLFSKEHEELVGIYASQLAAHRCIDLFVHMMELRLNSSIHVKYKIFVSAMEYLPFSSVDDSKSNFEDIIERILLRSREVKVSKYDNLSDVAEQHRLQSLEKAKVIQWLCFTPPSTITNVKDVSEKLLLRALVH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_335126

• Blastp: Nuclear pore complex protein NUP107 from Arabidopsis with 71.27% of identity
• Blastx: Nuclear pore complex protein NUP107 from Arabidopsis with 71.27% of identity
• Eggnog: nuclear pore complex protein(ENOG410XRUG)
• Kegg: Link to kegg annotations (AT3G14120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460751.1)
• Pfam: Nuclear pore protein 84 / 107 (PF04121.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;