Protein coding transcript 110860

• Transcript: Ll_transcript_297306
• CDS coordinates: 1-882 (+)
• Peptide sequence: MSIRCNTCGNYIYKGTKFNSRKEDVIGETYLGIQIFRFYFKCTKCSAELTMKTDPQNSDYIVESGASRNYEPWRAEDEETDKMKQKRDAEELGDAMKSLENRTLDSKREMDILAALDEMKSMKSRHATVTVDEMLEALQRTAADKEKRLEEEDEKLIKSVVFHSSNAFVRRVRDEDIENEEETVQVSNAHGETSSNNPKRQKNSEDLPGNATDTPRKAPLDDSSKQENSRGGGGCGGGGGDGKLNPLVRISVIKKAVISDAAEPEQKNNEEDDKTNTTSGLLSLCQNYGSDDD*
• ORF Type: complete

Annotations of Ll_transcript_297306

• Blastp: Coiled-coil domain-containing protein 94 homolog from Dictyostelium with 53.57% of identity
• Blastx: Coiled-coil domain-containing protein 94 homolog from Dictyostelium with 58.82% of identity
• Eggnog: Coiled-coil domain-containing protein(COG5134)
• Kegg: Link to kegg annotations (DDB_G0279481)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426445.1)
• Pfam: Family of unknown function (DUF572) (PF04502.12)
• Rfam: -
• GO: -