| Transcript | Ll_transcript_296111 |
|---|---|
| CDS coordinates | 302-613 (+) |
| Peptide sequence | MGNILDRKNKPDTEVTSTLQSERSISKQDTYFAGAGSLSERRPESKPRPSTNKHLPTFKKSSTRGEGANSSTSTLTKLSSKLNFLKERRNLASNEGNESPKLEK |
| ORF Type | 3prime_partial |
| Blastp | Rho GTPase-activating protein REN1 from Arabidopsis with 39.58% of identity |
|---|---|
| Blastx | - |
| Eggnog | rho GTPase activating protein(ENOG410XR4E) |
| Kegg | Link to kegg annotations (AT4G24580) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019462320.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer