Protein coding transcript 110927

• Transcript: Ll_transcript_296318
• CDS coordinates: 1-399 (+)
• Peptide sequence: HLFNEFLMFYAVLILDVFICNTQTLKLSICEKDTMFDPVSLTCGHIFCYSCACSAASTSIVDGLKAADPKEKCPLCRKEGVYEDAVRLEELNILLARSCHEYWKQRLRTERAERVKQAKEHWELQFRTFMGV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_296318

• Blastp: E3 ubiquitin-protein ligase BAH1 from Arabidopsis with 65.74% of identity
• Blastx: E3 ubiquitin-protein ligase BAH1 from Arabidopsis with 65.74% of identity
• Eggnog: E3 ubiquitin-protein ligase BAH1-like(ENOG4110S99)
• Kegg: Link to kegg annotations (AT1G02860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441761.1)
• Pfam: Zinc finger, C3HC4 type (RING finger) (PF00097.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;