Protein coding transcript 110929

• Transcript: Ll_transcript_296322
• CDS coordinates: 123-455 (+)
• Peptide sequence: MEYFNLMTSIDTMFDPVSLTCGHIFCYSCACSAASTSIVDGLKAADPKEKCPLCRKEGVYEDAVRLEELNILLARSCHEYWKQRLRTERAERVKQAKEHWELQFRTFMGV*
• ORF Type: complete

Annotations of Ll_transcript_296322

• Blastp: E3 ubiquitin-protein ligase BAH1 from Arabidopsis with 66.34% of identity
• Blastx: E3 ubiquitin-protein ligase BAH1 from Arabidopsis with 66.34% of identity
• Eggnog: E3 ubiquitin-protein ligase BAH1-like(ENOG4110S99)
• Kegg: Link to kegg annotations (AT1G02860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441761.1)
• Pfam: RING-type zinc-finger (PF13445.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;