Protein coding transcript 111037

• Transcript: Ll_transcript_295143
• CDS coordinates: 172-648 (+)
• Peptide sequence: MNPQILFIFVLLLNLISISISLQDPNAINPKSTLSLAHVELTKYGFPVGLLPATTVLGYAVNQTSGEFTVRLGGACKITLPPDNYVATYSKTINGKIVNGRMAELDGIRVRALFKWWSITGIRSSGDDIVFEVGMVTAKYPSKNFDKSPACEGQHSSS*
• ORF Type: complete

Annotations of Ll_transcript_295143

• Blastp: Protein NRT1/ PTR FAMILY 5.10 from Arabidopsis with 62.5% of identity
• Blastx: Protein NRT1/ PTR FAMILY 5.10 from Arabidopsis with 62.5% of identity
• Eggnog: transporter(COG3104)
• Kegg: Link to kegg annotations (AT1G22540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458640.1)
• Pfam: POT family (PF00854.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;