Transcript | Ll_transcript_297404 |
---|---|
CDS coordinates | 1-411 (+) |
Peptide sequence | VAPQDFQKGDLLQVKVNKLTSIKTQLPYTYYSLPYCSPAKIQDSAENLGEVLRGDRIENSLYVFKMREPQMCNVVCNRKLDAKAAKEFKEKINDEYRVNMILDNLPLVVPIKMNNQDLTVYQLGFHVGLKGQYTGV* |
ORF Type | 5prime_partial |
Blastp | Transmembrane 9 superfamily member 8 from Arabidopsis with 75.91% of identity |
---|---|
Blastx | Transmembrane 9 superfamily member 8 from Arabidopsis with 75.91% of identity |
Eggnog | transmembrane 9 superfamily(ENOG410XPIW) |
Kegg | Link to kegg annotations (AT5G10840) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417202.1) |
Pfam | Endomembrane protein 70 (PF02990.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer